Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 20010..20317 | Replicon | chromosome |
Accession | NZ_CP109933 | ||
Organism | Staphylococcus aureus strain SASWT1215 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | NT398_RS00110 | Protein ID | WP_072482930.1 |
Coordinates | 20010..20186 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 20178..20317 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NT398_RS00090 (17840) | 17840..17992 | + | 153 | WP_001000058.1 | hypothetical protein | - |
NT398_RS00095 (18038) | 18038..18325 | + | 288 | WP_001262621.1 | hypothetical protein | - |
NT398_RS00100 (18381) | 18381..18755 | + | 375 | WP_000340977.1 | hypothetical protein | - |
NT398_RS00105 (19128) | 19128..19901 | + | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
NT398_RS00110 (20010) | 20010..20186 | + | 177 | WP_072482930.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (20178) | 20178..20317 | - | 140 | NuclAT_0 | - | Antitoxin |
- (20178) | 20178..20317 | - | 140 | NuclAT_0 | - | Antitoxin |
- (20178) | 20178..20317 | - | 140 | NuclAT_0 | - | Antitoxin |
- (20178) | 20178..20317 | - | 140 | NuclAT_0 | - | Antitoxin |
NT398_RS00115 (20239) | 20239..20346 | - | 108 | Protein_22 | hypothetical protein | - |
NT398_RS00120 (20398) | 20398..20652 | + | 255 | WP_000611512.1 | phage holin | - |
NT398_RS00125 (20664) | 20664..21419 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
NT398_RS00130 (21610) | 21610..22101 | + | 492 | WP_000920041.1 | staphylokinase | - |
NT398_RS00135 (22754) | 22754..23089 | + | 336 | Protein_26 | SH3 domain-containing protein | - |
NT398_RS00140 (23599) | 23599..23939 | + | 341 | Protein_27 | complement inhibitor SCIN-A | - |
NT398_RS00145 (23992) | 23992..24252 | - | 261 | WP_001791826.1 | hypothetical protein | - |
NT398_RS00150 (24563) | 24563..24742 | - | 180 | WP_000669789.1 | hypothetical protein | - |
NT398_RS00155 (25114) | 25114..25311 | - | 198 | WP_000239610.1 | phospholipase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sea / sak / scn / scn | 1..23939 | 23938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T262434 WP_072482930.1 NZ_CP109933:20010-20186 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT262434 NZ_CP109933:c20317-20178 [Staphylococcus aureus]
ATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|