Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 20010..20348 | Replicon | chromosome |
Accession | NZ_CP109933 | ||
Organism | Staphylococcus aureus strain SASWT1215 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | NT398_RS00110 | Protein ID | WP_072482930.1 |
Coordinates | 20010..20186 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 20174..20348 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NT398_RS00090 | 17840..17992 | + | 153 | WP_001000058.1 | hypothetical protein | - |
NT398_RS00095 | 18038..18325 | + | 288 | WP_001262621.1 | hypothetical protein | - |
NT398_RS00100 | 18381..18755 | + | 375 | WP_000340977.1 | hypothetical protein | - |
NT398_RS00105 | 19128..19901 | + | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
NT398_RS00110 | 20010..20186 | + | 177 | WP_072482930.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 20174..20348 | - | 175 | - | - | Antitoxin |
NT398_RS00120 | 20398..20652 | + | 255 | WP_000611512.1 | phage holin | - |
NT398_RS00125 | 20664..21419 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
NT398_RS00130 | 21610..22101 | + | 492 | WP_000920041.1 | staphylokinase | - |
NT398_RS00135 | 22754..23089 | + | 336 | Protein_26 | SH3 domain-containing protein | - |
NT398_RS00140 | 23599..23939 | + | 341 | Protein_27 | complement inhibitor SCIN-A | - |
NT398_RS00145 | 23992..24252 | - | 261 | WP_001791826.1 | hypothetical protein | - |
NT398_RS00150 | 24563..24742 | - | 180 | WP_000669789.1 | hypothetical protein | - |
NT398_RS00155 | 25114..25311 | - | 198 | WP_000239610.1 | phospholipase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sea / sak / scn / scn | 1..23939 | 23938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T262432 WP_072482930.1 NZ_CP109933:20010-20186 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT262432 NZ_CP109933:c20348-20174 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|