Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 1544079..1544674 | Replicon | chromosome |
| Accession | NZ_CP109931 | ||
| Organism | Pseudomonas aeruginosa strain PALA42 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | PALA42_RS07205 | Protein ID | WP_003117425.1 |
| Coordinates | 1544079..1544357 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA42_RS07210 | Protein ID | WP_003113527.1 |
| Coordinates | 1544369..1544674 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA42_RS07185 (PALA42_01422) | 1539505..1540743 | + | 1239 | WP_003113524.1 | dipeptidase | - |
| PALA42_RS07190 (PALA42_01423) | 1540805..1541452 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA42_RS07195 (PALA42_01424) | 1541522..1543750 | - | 2229 | WP_004352671.1 | TonB-dependent receptor | - |
| PALA42_RS07200 | 1543898..1544026 | + | 129 | Protein_1419 | integrase | - |
| PALA42_RS07205 | 1544079..1544357 | + | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA42_RS07210 (PALA42_01425) | 1544369..1544674 | + | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA42_RS07220 (PALA42_01427) | 1545081..1546181 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| PALA42_RS07225 (PALA42_01428) | 1546222..1546806 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| PALA42_RS07230 (PALA42_01429) | 1546848..1547462 | - | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| PALA42_RS07235 (PALA42_01430) | 1547579..1548520 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| PALA42_RS07245 (PALA42_01432) | 1548687..1549535 | - | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T262420 WP_003117425.1 NZ_CP109931:1544079-1544357 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|