Detailed information of TA system TA262418

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 35659..35928
• Replicon: plasmid pP19A_1
• Accession: NZ_CP109930
• Organism: Escherichia coli O6:K2:H1 strain C 691-04A

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: N8A71_RS24950
• Protein ID: WP_001372321.1
• Coordinates: 35803..35928 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	35659..35724 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
N8A71_RS24905	30741..31028	+	288	WP_097767096.1	hypothetical protein	-
N8A71_RS24910	31299..31418	+	120	WP_001426400.1	hypothetical protein	-
N8A71_RS24915	31444..31977	+	534	WP_032180770.1	single-stranded DNA-binding protein	-
N8A71_RS24920	32035..32268	+	234	WP_000006012.1	DUF905 family protein	-
N8A71_RS24925	32327..34285	+	1959	WP_032297631.1	ParB/RepB/Spo0J family partition protein	-
N8A71_RS24930	34340..34774	+	435	WP_016239106.1	conjugation system SOS inhibitor PsiB	-
N8A71_RS24935	34771..35533	+	763	Protein_45	plasmid SOS inhibition protein A	-
N8A71_RS24940	35502..35690	-	189	WP_001336239.1	hypothetical protein	-
-	35502..35726	+	225	NuclAT_0	-	-
-	35502..35726	+	225	NuclAT_0	-	-
-	35502..35726	+	225	NuclAT_0	-	-
-	35502..35726	+	225	NuclAT_0	-	-
-	35659..35724	-	66	-	-	Antitoxin
N8A71_RS24945	35712..35861	+	150	Protein_47	plasmid maintenance protein Mok	-
N8A71_RS24950	35803..35928	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
N8A71_RS24955	36148..36378	+	231	WP_071593758.1	hypothetical protein	-
N8A71_RS24960	36376..36573	-	198	Protein_50	hypothetical protein	-
N8A71_RS24965	36575..36862	+	288	WP_000107535.1	hypothetical protein	-
N8A71_RS24970	36982..37803	+	822	WP_001234469.1	DUF932 domain-containing protein	-
N8A71_RS24975	38098..38700	-	603	WP_077539848.1	transglycosylase SLT domain-containing protein	-
N8A71_RS24980	39031..39414	+	384	WP_001151562.1	conjugal transfer relaxosome DNA-binding protein TraM	-
N8A71_RS24985	39608..40294	+	687	WP_016230906.1	PAS domain-containing protein	-
N8A71_RS24990	40388..40615	+	228	WP_264427316.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..77976	77976

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T262418 WP_001372321.1 NZ_CP109930:35803-35928 [Escherichia coli O6:K2:H1]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT262418 NZ_CP109930:c35724-35659 [Escherichia coli O6:K2:H1]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin