Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4959395..4959997 | Replicon | chromosome |
Accession | NZ_CP109929 | ||
Organism | Escherichia coli O6:K2:H1 strain C 691-04A |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | N8A71_RS23675 | Protein ID | WP_000897302.1 |
Coordinates | 4959686..4959997 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N8A71_RS23670 | Protein ID | WP_000356397.1 |
Coordinates | 4959395..4959685 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A71_RS23645 (4955468) | 4955468..4956370 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
N8A71_RS23650 (4956367) | 4956367..4957002 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
N8A71_RS23655 (4956999) | 4956999..4957928 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
N8A71_RS23660 (4958144) | 4958144..4958362 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
N8A71_RS23665 (4958758) | 4958758..4959036 | - | 279 | WP_001296612.1 | hypothetical protein | - |
N8A71_RS23670 (4959395) | 4959395..4959685 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
N8A71_RS23675 (4959686) | 4959686..4959997 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
N8A71_RS23680 (4960227) | 4960227..4961135 | + | 909 | WP_001305059.1 | alpha/beta hydrolase | - |
N8A71_RS23685 (4961199) | 4961199..4962140 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
N8A71_RS23690 (4962185) | 4962185..4962622 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
N8A71_RS23695 (4962619) | 4962619..4963491 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
N8A71_RS23700 (4963485) | 4963485..4964084 | - | 600 | WP_001443191.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T262415 WP_000897302.1 NZ_CP109929:c4959997-4959686 [Escherichia coli O6:K2:H1]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|