Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4219541..4219799 | Replicon | chromosome |
Accession | NZ_CP109929 | ||
Organism | Escherichia coli O6:K2:H1 strain C 691-04A |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | N8A71_RS20205 | Protein ID | WP_000809168.1 |
Coordinates | 4219647..4219799 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4219541..4219598 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A71_RS20190 | 4215370..4216629 | - | 1260 | WP_000494928.1 | hypothetical protein | - |
N8A71_RS20195 | 4216758..4218251 | - | 1494 | WP_001443162.1 | sulfatase-like hydrolase/transferase | - |
N8A71_RS20200 | 4218271..4219032 | - | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
- | 4219541..4219598 | - | 58 | - | - | Antitoxin |
N8A71_RS20205 | 4219647..4219799 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
N8A71_RS20210 | 4219993..4221105 | - | 1113 | WP_001300563.1 | IS4-like element IS421 family transposase | - |
N8A71_RS20215 | 4221253..4222383 | - | 1131 | WP_001118465.1 | molecular chaperone DnaJ | - |
N8A71_RS20220 | 4222472..4224388 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T262410 WP_000809168.1 NZ_CP109929:4219647-4219799 [Escherichia coli O6:K2:H1]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT262410 NZ_CP109929:c4219598-4219541 [Escherichia coli O6:K2:H1]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|