Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2604161..2604723 | Replicon | chromosome |
Accession | NZ_CP109929 | ||
Organism | Escherichia coli O6:K2:H1 strain C 691-04A |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1Q1V8 |
Locus tag | N8A71_RS12400 | Protein ID | WP_000605675.1 |
Coordinates | 2604161..2604439 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1PAQ1 |
Locus tag | N8A71_RS12405 | Protein ID | WP_000781370.1 |
Coordinates | 2604439..2604723 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A71_RS12375 (2599747) | 2599747..2600178 | - | 432 | WP_000152307.1 | peroxiredoxin OsmC | - |
N8A71_RS12380 (2600523) | 2600523..2600738 | + | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
N8A71_RS12385 (2600840) | 2600840..2600977 | + | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
N8A71_RS12390 (2601134) | 2601134..2602831 | + | 1698 | WP_000433460.1 | malate dehydrogenase | - |
N8A71_RS12395 (2602965) | 2602965..2603975 | + | 1011 | WP_000642412.1 | alcohol dehydrogenase AdhP | - |
N8A71_RS12400 (2604161) | 2604161..2604439 | + | 279 | WP_000605675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8A71_RS12405 (2604439) | 2604439..2604723 | + | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
N8A71_RS12410 (2604952) | 2604952..2605605 | - | 654 | WP_000045646.1 | formate dehydrogenase-N subunit gamma | - |
N8A71_RS12415 (2605598) | 2605598..2606482 | - | 885 | WP_001240584.1 | formate dehydrogenase N subunit beta | - |
N8A71_RS12420 (2606495) | 2606495..2609542 | - | 3048 | WP_011076399.1 | formate dehydrogenase-N subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10537.16 Da Isoelectric Point: 7.3206
>T262405 WP_000605675.1 NZ_CP109929:2604161-2604439 [Escherichia coli O6:K2:H1]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1Q1V8 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2ICT | |
PDB | 2ICP | |
AlphaFold DB | A0A829CUG6 |