Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1938015..1938846 Replicon chromosome
Accession NZ_CP109929
Organism Escherichia coli O6:K2:H1 strain C 691-04A

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag N8A71_RS09185 Protein ID WP_000854814.1
Coordinates 1938015..1938389 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1PWQ3
Locus tag N8A71_RS09190 Protein ID WP_001285586.1
Coordinates 1938478..1938846 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8A71_RS09150 (1933419) 1933419..1934639 + 1221 WP_000343765.1 ISL3-like element ISEc53 family transposase -
N8A71_RS09155 (1934696) 1934696..1935169 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
N8A71_RS09160 (1935367) 1935367..1936425 + 1059 WP_001200890.1 FUSC family protein -
N8A71_RS09165 (1936597) 1936597..1936926 + 330 WP_001566802.1 DUF496 family protein -
N8A71_RS09170 (1937027) 1937027..1937383 - 357 WP_000929389.1 EutP/PduV family microcompartment system protein -
N8A71_RS09175 (1937698) 1937698..1937778 - 81 Protein_1800 hypothetical protein -
N8A71_RS09180 (1937824) 1937824..1938018 - 195 WP_000988601.1 DUF5983 family protein -
N8A71_RS09185 (1938015) 1938015..1938389 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
N8A71_RS09190 (1938478) 1938478..1938846 - 369 WP_001285586.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N8A71_RS09195 (1938920) 1938920..1939141 - 222 WP_000692323.1 DUF987 domain-containing protein -
N8A71_RS09200 (1939210) 1939210..1939686 - 477 WP_021560614.1 RadC family protein -
N8A71_RS09205 (1939702) 1939702..1940187 - 486 WP_000213703.1 antirestriction protein -
N8A71_RS09210 (1940278) 1940278..1941099 - 822 WP_001234569.1 DUF932 domain-containing protein -
N8A71_RS09215 (1941320) 1941320..1941730 - 411 WP_000846704.1 hypothetical protein -
N8A71_RS09220 (1941746) 1941746..1942423 - 678 WP_001362823.1 hypothetical protein -
N8A71_RS09225 (1942559) 1942559..1943629 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1933419..1934639 1220


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T262399 WP_000854814.1 NZ_CP109929:c1938389-1938015 [Escherichia coli O6:K2:H1]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13563.41 Da        Isoelectric Point: 5.0468

>AT262399 WP_001285586.1 NZ_CP109929:c1938846-1938478 [Escherichia coli O6:K2:H1]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB S1PWQ3

References