Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 622723..623522 | Replicon | chromosome |
Accession | NZ_CP109929 | ||
Organism | Escherichia coli O6:K2:H1 strain C 691-04A |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | Q8FDB4 |
Locus tag | N8A71_RS03060 | Protein ID | WP_000347252.1 |
Coordinates | 622723..623187 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | N8A71_RS03065 | Protein ID | WP_001296435.1 |
Coordinates | 623187..623522 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A71_RS03030 (617724) | 617724..618158 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
N8A71_RS03035 (618176) | 618176..619054 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N8A71_RS03040 (619044) | 619044..619823 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N8A71_RS03045 (619834) | 619834..620307 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N8A71_RS03050 (620330) | 620330..621610 | - | 1281 | WP_000681926.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N8A71_RS03055 (621859) | 621859..622668 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N8A71_RS03060 (622723) | 622723..623187 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N8A71_RS03065 (623187) | 623187..623522 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N8A71_RS03070 (623671) | 623671..625242 | - | 1572 | WP_001273940.1 | galactarate dehydratase | - |
N8A71_RS03075 (625617) | 625617..626951 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
N8A71_RS03080 (626967) | 626967..627737 | + | 771 | WP_001058223.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T262394 WP_000347252.1 NZ_CP109929:c623187-622723 [Escherichia coli O6:K2:H1]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|