Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4702040..4702642 | Replicon | chromosome |
| Accession | NZ_CP109921 | ||
| Organism | Escherichia coli O2:K2:H1 strain C 237-04 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | N7L43_RS22675 | Protein ID | WP_000897302.1 |
| Coordinates | 4702331..4702642 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N7L43_RS22670 | Protein ID | WP_000356397.1 |
| Coordinates | 4702040..4702330 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7L43_RS22645 (4698113) | 4698113..4699015 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| N7L43_RS22650 (4699012) | 4699012..4699647 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N7L43_RS22655 (4699644) | 4699644..4700573 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| N7L43_RS22660 (4700789) | 4700789..4701007 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| N7L43_RS22665 (4701403) | 4701403..4701681 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| N7L43_RS22670 (4702040) | 4702040..4702330 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N7L43_RS22675 (4702331) | 4702331..4702642 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| N7L43_RS22680 (4702872) | 4702872..4703780 | + | 909 | WP_001305059.1 | alpha/beta hydrolase | - |
| N7L43_RS22685 (4703844) | 4703844..4704785 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N7L43_RS22690 (4704830) | 4704830..4705267 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| N7L43_RS22695 (4705264) | 4705264..4706136 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| N7L43_RS22700 (4706130) | 4706130..4706729 | - | 600 | WP_001443191.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T262370 WP_000897302.1 NZ_CP109921:c4702642-4702331 [Escherichia coli O2:K2:H1]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|