Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
| Location | 4154656..4155068 | Replicon | chromosome |
| Accession | NZ_CP109921 | ||
| Organism | Escherichia coli O2:K2:H1 strain C 237-04 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | Q8FA88 |
| Locus tag | N7L43_RS20175 | Protein ID | WP_000132630.1 |
| Coordinates | 4154727..4155068 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4154656..4154732 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7L43_RS20165 (4151268) | 4151268..4152737 | + | 1470 | WP_001315223.1 | type I restriction-modification system subunit M | - |
| N7L43_RS20170 (4152737) | 4152737..4154506 | + | 1770 | WP_000110076.1 | restriction endonuclease subunit S | - |
| - (4154656) | 4154656..4154732 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4154656) | 4154656..4154732 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4154656) | 4154656..4154732 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4154656) | 4154656..4154732 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4154656) | 4154656..4154732 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4154656) | 4154656..4154732 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4154656) | 4154656..4154732 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4154656) | 4154656..4154732 | - | 77 | NuclAT_7 | - | Antitoxin |
| N7L43_RS20175 (4154727) | 4154727..4155068 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
| N7L43_RS20180 (4155115) | 4155115..4156278 | - | 1164 | WP_072202028.1 | DUF1524 domain-containing protein | - |
| N7L43_RS20185 (4156326) | 4156326..4157208 | - | 883 | Protein_3960 | DUF262 domain-containing protein | - |
| N7L43_RS20190 (4157614) | 4157614..4158534 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| N7L43_RS20195 (4158719) | 4158719..4159999 | + | 1281 | WP_001304526.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T262364 WP_000132630.1 NZ_CP109921:4154727-4155068 [Escherichia coli O2:K2:H1]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT262364 NZ_CP109921:c4154732-4154656 [Escherichia coli O2:K2:H1]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|