Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 731246..731939 | Replicon | chromosome |
| Accession | NZ_CP109921 | ||
| Organism | Escherichia coli O2:K2:H1 strain C 237-04 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | N7L43_RS03595 | Protein ID | WP_000415584.1 |
| Coordinates | 731246..731542 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | N7L43_RS03600 | Protein ID | WP_000650107.1 |
| Coordinates | 731544..731939 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7L43_RS03560 (726334) | 726334..726648 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| N7L43_RS03565 (726679) | 726679..727260 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| N7L43_RS03570 (727579) | 727579..727911 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| N7L43_RS03575 (727957) | 727957..729306 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| N7L43_RS03580 (729303) | 729303..729962 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| N7L43_RS03585 (730114) | 730114..730506 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| N7L43_RS03590 (730559) | 730559..731041 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| N7L43_RS03595 (731246) | 731246..731542 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| N7L43_RS03600 (731544) | 731544..731939 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| N7L43_RS03605 (732072) | 732072..733679 | + | 1608 | WP_021561146.1 | ABC transporter substrate-binding protein | - |
| N7L43_RS03610 (733817) | 733817..736075 | + | 2259 | WP_021519502.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T262351 WP_000415584.1 NZ_CP109921:731246-731542 [Escherichia coli O2:K2:H1]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT262351 WP_000650107.1 NZ_CP109921:731544-731939 [Escherichia coli O2:K2:H1]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|