Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5926752..5927347 | Replicon | chromosome |
Accession | NZ_CP109920 | ||
Organism | Pseudomonas aeruginosa strain PALA39 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA39_RS28335 | Protein ID | WP_003117425.1 |
Coordinates | 5927069..5927347 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA39_RS28330 | Protein ID | WP_003099268.1 |
Coordinates | 5926752..5927057 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA39_RS28300 | 5922697..5922987 | - | 291 | WP_031640334.1 | DUF5447 family protein | - |
PALA39_RS28305 (PALA39_05596) | 5923163..5923435 | - | 273 | WP_004352675.1 | hypothetical protein | - |
PALA39_RS28310 (PALA39_05597) | 5923545..5923811 | + | 267 | WP_023088595.1 | hypothetical protein | - |
PALA39_RS28315 | 5923867..5924202 | + | 336 | WP_031637200.1 | hypothetical protein | - |
PALA39_RS28320 (PALA39_05598) | 5924355..5925572 | + | 1218 | WP_071534385.1 | AAA family ATPase | - |
PALA39_RS28325 (PALA39_05599) | 5925573..5926301 | + | 729 | WP_124075417.1 | hypothetical protein | - |
PALA39_RS28330 (PALA39_05600) | 5926752..5927057 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA39_RS28335 | 5927069..5927347 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA39_RS28340 | 5927400..5927528 | - | 129 | Protein_5598 | integrase | - |
PALA39_RS28345 (PALA39_05601) | 5927676..5929904 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
PALA39_RS28350 (PALA39_05602) | 5929974..5930621 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA39_RS28355 (PALA39_05603) | 5930683..5931921 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T262349 WP_003117425.1 NZ_CP109920:c5927347-5927069 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|