Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5306287..5306882 | Replicon | chromosome |
| Accession | NZ_CP109919 | ||
| Organism | Pseudomonas aeruginosa strain PALA56 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | PALA56_RS24860 | Protein ID | WP_003117425.1 |
| Coordinates | 5306604..5306882 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA56_RS24855 | Protein ID | WP_003113527.1 |
| Coordinates | 5306287..5306592 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA56_RS24820 (PALA56_04931) | 5301427..5302275 | + | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| PALA56_RS24830 (PALA56_04933) | 5302442..5303383 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| PALA56_RS24835 (PALA56_04934) | 5303500..5304114 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| PALA56_RS24840 (PALA56_04935) | 5304156..5304740 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| PALA56_RS24845 (PALA56_04936) | 5304781..5305881 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| PALA56_RS24855 (PALA56_04938) | 5306287..5306592 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA56_RS24860 | 5306604..5306882 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA56_RS24865 | 5306935..5307063 | - | 129 | Protein_4910 | integrase | - |
| PALA56_RS24870 (PALA56_04939) | 5307211..5309439 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| PALA56_RS24875 (PALA56_04940) | 5309509..5310156 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA56_RS24880 (PALA56_04941) | 5310218..5311456 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T262341 WP_003117425.1 NZ_CP109919:c5306882-5306604 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|