Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5437854..5438449 | Replicon | chromosome |
Accession | NZ_CP109918 | ||
Organism | Pseudomonas aeruginosa strain PALA55 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PALA55_RS25315 | Protein ID | WP_003113526.1 |
Coordinates | 5438171..5438449 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA55_RS25310 | Protein ID | WP_003099268.1 |
Coordinates | 5437854..5438159 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA55_RS25275 (PALA55_05004) | 5432994..5433842 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PALA55_RS25285 (PALA55_05006) | 5434009..5434950 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA55_RS25290 (PALA55_05007) | 5435067..5435681 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA55_RS25295 (PALA55_05008) | 5435723..5436307 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA55_RS25300 (PALA55_05009) | 5436348..5437448 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA55_RS25310 (PALA55_05011) | 5437854..5438159 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA55_RS25315 | 5438171..5438449 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA55_RS25320 | 5438502..5438630 | - | 129 | Protein_5000 | integrase | - |
PALA55_RS25325 (PALA55_05012) | 5438778..5441006 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PALA55_RS25330 (PALA55_05013) | 5441076..5441723 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA55_RS25335 (PALA55_05014) | 5441785..5443023 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T262335 WP_003113526.1 NZ_CP109918:c5438449-5438171 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|