Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsRA (relBE)/MqsR-MqsA
Location 458085..458791 Replicon chromosome
Accession NZ_CP109897
Organism Xylella fastidiosa subsp. fastidiosa strain XYL461

Toxin (Protein)


Gene name mqsR Uniprot ID Q87EE2
Locus tag OK116_RS02115 Protein ID WP_004090696.1
Coordinates 458085..458387 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name mqsA Uniprot ID Q87EE1
Locus tag OK116_RS02120 Protein ID WP_004090697.1
Coordinates 458390..458791 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK116_RS02080 (OK116_02075) 453853..454554 - 702 WP_228446162.1 contractile injection system protein, VgrG/Pvc8 family -
OK116_RS02085 (OK116_02080) 454472..455443 - 972 WP_011097609.1 hypothetical protein -
OK116_RS02090 (OK116_02085) 455451..456008 - 558 WP_011097610.1 phage tail protein I -
OK116_RS02095 (OK116_02090) 456001..456894 - 894 WP_011097611.1 baseplate J/gp47 family protein -
OK116_RS02100 (OK116_02095) 456894..457256 - 363 WP_014607615.1 GPW/gp25 family protein -
OK116_RS02105 (OK116_02100) 457430..457711 + 282 WP_004090695.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK116_RS02110 (OK116_02105) 457722..457997 + 276 WP_004085172.1 HigA family addiction module antitoxin -
OK116_RS02115 (OK116_02110) 458085..458387 + 303 WP_004090696.1 type II toxin-antitoxin system MqsR family toxin Toxin
OK116_RS02120 (OK116_02115) 458390..458791 + 402 WP_004090697.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
OK116_RS02125 (OK116_02120) 458860..459447 - 588 WP_011097612.1 phage baseplate assembly protein V -
OK116_RS02130 (OK116_02125) 459444..459986 - 543 WP_011097613.1 hypothetical protein -
OK116_RS02135 (OK116_02130) 459962..460483 - 522 WP_011097614.1 hypothetical protein -
OK116_RS02140 (OK116_02135) 460480..460803 - 324 WP_011097935.1 hypothetical protein -
OK116_RS02145 (OK116_02140) 460803..461063 - 261 WP_011097616.1 hypothetical protein -
OK116_RS02150 (OK116_02145) 461081..462955 - 1875 WP_011097617.1 phage major capsid protein -
OK116_RS02155 (OK116_02150) 462952..463584 - 633 WP_011097618.1 phage portal protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 446028..468861 22833


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(2-99)

Antitoxin

Cro/C1-type helix-turn-helix domain

(74-127)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 10948.71 Da        Isoelectric Point: 8.0251

>T262320 WP_004090696.1 NZ_CP109897:458085-458387 [Xylella fastidiosa subsp. fastidiosa]
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL

Download         Length: 303 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14944.02 Da        Isoelectric Point: 7.1650

>AT262320 WP_004090697.1 NZ_CP109897:458390-458791 [Xylella fastidiosa subsp. fastidiosa]
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSS

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87EE2

Antitoxin

Source ID Structure
AlphaFold DB Q87EE1

References