Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 457430..457997 | Replicon | chromosome |
Accession | NZ_CP109897 | ||
Organism | Xylella fastidiosa subsp. fastidiosa strain XYL461 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q87EE4 |
Locus tag | OK116_RS02105 | Protein ID | WP_004090695.1 |
Coordinates | 457430..457711 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | OK116_RS02110 | Protein ID | WP_004085172.1 |
Coordinates | 457722..457997 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK116_RS02080 (OK116_02075) | 453853..454554 | - | 702 | WP_228446162.1 | contractile injection system protein, VgrG/Pvc8 family | - |
OK116_RS02085 (OK116_02080) | 454472..455443 | - | 972 | WP_011097609.1 | hypothetical protein | - |
OK116_RS02090 (OK116_02085) | 455451..456008 | - | 558 | WP_011097610.1 | phage tail protein I | - |
OK116_RS02095 (OK116_02090) | 456001..456894 | - | 894 | WP_011097611.1 | baseplate J/gp47 family protein | - |
OK116_RS02100 (OK116_02095) | 456894..457256 | - | 363 | WP_014607615.1 | GPW/gp25 family protein | - |
OK116_RS02105 (OK116_02100) | 457430..457711 | + | 282 | WP_004090695.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK116_RS02110 (OK116_02105) | 457722..457997 | + | 276 | WP_004085172.1 | HigA family addiction module antitoxin | Antitoxin |
OK116_RS02115 (OK116_02110) | 458085..458387 | + | 303 | WP_004090696.1 | type II toxin-antitoxin system MqsR family toxin | - |
OK116_RS02120 (OK116_02115) | 458390..458791 | + | 402 | WP_004090697.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
OK116_RS02125 (OK116_02120) | 458860..459447 | - | 588 | WP_011097612.1 | phage baseplate assembly protein V | - |
OK116_RS02130 (OK116_02125) | 459444..459986 | - | 543 | WP_011097613.1 | hypothetical protein | - |
OK116_RS02135 (OK116_02130) | 459962..460483 | - | 522 | WP_011097614.1 | hypothetical protein | - |
OK116_RS02140 (OK116_02135) | 460480..460803 | - | 324 | WP_011097935.1 | hypothetical protein | - |
OK116_RS02145 (OK116_02140) | 460803..461063 | - | 261 | WP_011097616.1 | hypothetical protein | - |
OK116_RS02150 (OK116_02145) | 461081..462955 | - | 1875 | WP_011097617.1 | phage major capsid protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 446028..468861 | 22833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10639.21 Da Isoelectric Point: 10.0980
>T262318 WP_004090695.1 NZ_CP109897:457430-457711 [Xylella fastidiosa subsp. fastidiosa]
MIKSFRHKGIQQFFLKGSTAGIQTKHAAKLRIQLTALESAKRPEDMNAPGWKLHPLKGADLKGHWSIWVNGNYRLTFAFE
GEDAILVDYQDYH
MIKSFRHKGIQQFFLKGSTAGIQTKHAAKLRIQLTALESAKRPEDMNAPGWKLHPLKGADLKGHWSIWVNGNYRLTFAFE
GEDAILVDYQDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|