Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsRA (relBE)/MqsR-MqsA
Location 457960..458666 Replicon chromosome
Accession NZ_CP109894
Organism Xylella fastidiosa subsp. fastidiosa strain CFBP8351

Toxin (Protein)


Gene name mqsR Uniprot ID Q87EE2
Locus tag OK118_RS01905 Protein ID WP_004090696.1
Coordinates 457960..458262 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name mqsA Uniprot ID Q87EE1
Locus tag OK118_RS01910 Protein ID WP_004090697.1
Coordinates 458265..458666 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK118_RS01870 (OK118_01870) 453728..454417 - 690 WP_012382453.1 contractile injection system protein, VgrG/Pvc8 family -
OK118_RS01875 (OK118_01875) 454347..455318 - 972 WP_011097609.1 hypothetical protein -
OK118_RS01880 (OK118_01880) 455326..455883 - 558 WP_011097610.1 phage tail protein I -
OK118_RS01885 (OK118_01885) 455876..456769 - 894 WP_011097611.1 baseplate J/gp47 family protein -
OK118_RS01890 (OK118_01890) 456769..457131 - 363 WP_014607615.1 GPW/gp25 family protein -
OK118_RS01895 (OK118_01895) 457305..457586 + 282 WP_004090695.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK118_RS01900 (OK118_01900) 457597..457872 + 276 WP_004085172.1 HigA family addiction module antitoxin -
OK118_RS01905 (OK118_01905) 457960..458262 + 303 WP_004090696.1 type II toxin-antitoxin system MqsR family toxin Toxin
OK118_RS01910 (OK118_01910) 458265..458666 + 402 WP_004090697.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
OK118_RS01915 (OK118_01915) 458735..459322 - 588 WP_011097612.1 phage baseplate assembly protein V -
OK118_RS01920 (OK118_01920) 459319..459861 - 543 WP_011097613.1 hypothetical protein -
OK118_RS01925 (OK118_01925) 459837..460358 - 522 WP_011097614.1 hypothetical protein -
OK118_RS01930 (OK118_01930) 460355..460678 - 324 WP_011097935.1 hypothetical protein -
OK118_RS01935 (OK118_01935) 460678..460938 - 261 WP_011097616.1 hypothetical protein -
OK118_RS01940 (OK118_01940) 460956..462830 - 1875 WP_011097617.1 phage major capsid protein -
OK118_RS01945 (OK118_01945) 462827..463459 - 633 WP_011097618.1 phage portal protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 445903..468736 22833


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(2-99)

Antitoxin

Cro/C1-type helix-turn-helix domain

(74-127)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 10948.71 Da        Isoelectric Point: 8.0251

>T262311 WP_004090696.1 NZ_CP109894:457960-458262 [Xylella fastidiosa subsp. fastidiosa]
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL

Download         Length: 303 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14944.02 Da        Isoelectric Point: 7.1650

>AT262311 WP_004090697.1 NZ_CP109894:458265-458666 [Xylella fastidiosa subsp. fastidiosa]
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSS

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87EE2

Antitoxin

Source ID Structure
AlphaFold DB Q87EE1

References