Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 457076..457643 | Replicon | chromosome |
| Accession | NZ_CP109891 | ||
| Organism | Xylella fastidiosa subsp. fastidiosa strain CFBP8083 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q87EE4 |
| Locus tag | OK113_RS01890 | Protein ID | WP_004090695.1 |
| Coordinates | 457076..457357 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | OK113_RS01895 | Protein ID | WP_004085172.1 |
| Coordinates | 457368..457643 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK113_RS01865 (OK113_01865) | 453499..454188 | - | 690 | WP_012382453.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| OK113_RS01870 (OK113_01870) | 454118..455089 | - | 972 | WP_159241593.1 | hypothetical protein | - |
| OK113_RS01875 (OK113_01875) | 455097..455654 | - | 558 | WP_011097610.1 | phage tail protein I | - |
| OK113_RS01880 (OK113_01880) | 455647..456540 | - | 894 | WP_011097611.1 | baseplate J/gp47 family protein | - |
| OK113_RS01885 (OK113_01885) | 456540..456902 | - | 363 | WP_014607615.1 | GPW/gp25 family protein | - |
| OK113_RS01890 (OK113_01890) | 457076..457357 | + | 282 | WP_004090695.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OK113_RS01895 (OK113_01895) | 457368..457643 | + | 276 | WP_004085172.1 | HigA family addiction module antitoxin | Antitoxin |
| OK113_RS01900 (OK113_01900) | 457731..458033 | + | 303 | WP_004090696.1 | type II toxin-antitoxin system MqsR family toxin | - |
| OK113_RS01905 (OK113_01905) | 458036..458437 | + | 402 | WP_004090697.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
| OK113_RS01910 (OK113_01910) | 458506..459093 | - | 588 | WP_004090703.1 | phage baseplate assembly protein V | - |
| OK113_RS01915 (OK113_01915) | 459090..459632 | - | 543 | WP_011097613.1 | hypothetical protein | - |
| OK113_RS01920 (OK113_01920) | 459608..460129 | - | 522 | WP_057683415.1 | hypothetical protein | - |
| OK113_RS01925 (OK113_01925) | 460126..460449 | - | 324 | WP_038233035.1 | hypothetical protein | - |
| OK113_RS01930 (OK113_01930) | 460449..460709 | - | 261 | WP_011097616.1 | hypothetical protein | - |
| OK113_RS01935 (OK113_01935) | 460727..462601 | - | 1875 | WP_140161485.1 | phage major capsid protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 445674..469587 | 23913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10639.21 Da Isoelectric Point: 10.0980
>T262300 WP_004090695.1 NZ_CP109891:457076-457357 [Xylella fastidiosa subsp. fastidiosa]
MIKSFRHKGIQQFFLKGSTAGIQTKHAAKLRIQLTALESAKRPEDMNAPGWKLHPLKGADLKGHWSIWVNGNYRLTFAFE
GEDAILVDYQDYH
MIKSFRHKGIQQFFLKGSTAGIQTKHAAKLRIQLTALESAKRPEDMNAPGWKLHPLKGADLKGHWSIWVNGNYRLTFAFE
GEDAILVDYQDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|