Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsRA (relBE)/MqsR-MqsA
Location 457961..458667 Replicon chromosome
Accession NZ_CP109890
Organism Xylella fastidiosa subsp. fastidiosa strain WM1-1

Toxin (Protein)


Gene name mqsR Uniprot ID Q87EE2
Locus tag OK119_RS01915 Protein ID WP_004090696.1
Coordinates 457961..458263 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name mqsA Uniprot ID Q87EE1
Locus tag OK119_RS01920 Protein ID WP_004090697.1
Coordinates 458266..458667 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK119_RS01880 (OK119_01880) 453729..454418 - 690 WP_012382453.1 contractile injection system protein, VgrG/Pvc8 family -
OK119_RS01885 (OK119_01885) 454348..455319 - 972 WP_159241593.1 hypothetical protein -
OK119_RS01890 (OK119_01890) 455327..455884 - 558 WP_011097610.1 phage tail protein I -
OK119_RS01895 (OK119_01895) 455877..456770 - 894 WP_011097611.1 baseplate J/gp47 family protein -
OK119_RS01900 (OK119_01900) 456770..457132 - 363 WP_014607615.1 GPW/gp25 family protein -
OK119_RS01905 (OK119_01905) 457306..457587 + 282 WP_004090695.1 type II toxin-antitoxin system RelE/ParE family toxin -
OK119_RS01910 (OK119_01910) 457598..457873 + 276 WP_004085172.1 HigA family addiction module antitoxin -
OK119_RS01915 (OK119_01915) 457961..458263 + 303 WP_004090696.1 type II toxin-antitoxin system MqsR family toxin Toxin
OK119_RS01920 (OK119_01920) 458266..458667 + 402 WP_004090697.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
OK119_RS01925 (OK119_01925) 458736..459323 - 588 WP_004090703.1 phage baseplate assembly protein V -
OK119_RS01930 (OK119_01930) 459320..459862 - 543 WP_011097613.1 hypothetical protein -
OK119_RS01935 (OK119_01935) 459838..460359 - 522 WP_057683415.1 hypothetical protein -
OK119_RS01940 (OK119_01940) 460356..460679 - 324 WP_038233035.1 hypothetical protein -
OK119_RS01945 (OK119_01945) 460679..460939 - 261 WP_011097616.1 hypothetical protein -
OK119_RS01950 (OK119_01950) 460957..462831 - 1875 WP_140161485.1 phage major capsid protein -
OK119_RS01955 (OK119_01955) 462815..463459 - 645 WP_038232805.1 phage portal protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 445904..469817 23913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(2-99)

Antitoxin

Cro/C1-type helix-turn-helix domain

(74-127)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 10948.71 Da        Isoelectric Point: 8.0251

>T262293 WP_004090696.1 NZ_CP109890:457961-458263 [Xylella fastidiosa subsp. fastidiosa]
MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL

Download         Length: 303 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14944.02 Da        Isoelectric Point: 7.1650

>AT262293 WP_004090697.1 NZ_CP109890:458266-458667 [Xylella fastidiosa subsp. fastidiosa]
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSS

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q87EE2

Antitoxin

Source ID Structure
AlphaFold DB Q87EE1

References