Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 38919..39565 | Replicon | plasmid pEC488-4 |
| Accession | NZ_CP109878 | ||
| Organism | Escherichia coli strain EC488 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NQ150_RS27270 | Protein ID | WP_000269912.1 |
| Coordinates | 39218..39565 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NQ150_RS27265 | Protein ID | WP_001673379.1 |
| Coordinates | 38919..39218 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ150_RS27230 (NQ150_27230) | 34057..34305 | + | 249 | WP_000730008.1 | hypothetical protein | - |
| NQ150_RS27235 (NQ150_27235) | 35433..35624 | + | 192 | WP_004105259.1 | hypothetical protein | - |
| NQ150_RS27240 (NQ150_27240) | 35621..36025 | + | 405 | Protein_51 | ORF6N domain-containing protein | - |
| NQ150_RS27245 (NQ150_27245) | 36194..36820 | + | 627 | WP_235179883.1 | Rha family transcriptional regulator | - |
| NQ150_RS27250 (NQ150_27250) | 37674..37889 | - | 216 | WP_261630074.1 | helix-turn-helix domain-containing protein | - |
| NQ150_RS27255 (NQ150_27255) | 37953..38327 | - | 375 | WP_001706261.1 | hypothetical protein | - |
| NQ150_RS27260 (NQ150_27260) | 38601..38885 | + | 285 | WP_001673380.1 | hypothetical protein | - |
| NQ150_RS27265 (NQ150_27265) | 38919..39218 | - | 300 | WP_001673379.1 | XRE family transcriptional regulator | Antitoxin |
| NQ150_RS27270 (NQ150_27270) | 39218..39565 | - | 348 | WP_000269912.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQ150_RS27275 (NQ150_27275) | 39810..40073 | - | 264 | WP_000424604.1 | hypothetical protein | - |
| NQ150_RS27280 (NQ150_27280) | 40097..40384 | - | 288 | WP_000356589.1 | hypothetical protein | - |
| NQ150_RS27285 (NQ150_27285) | 41028..42005 | - | 978 | WP_001704997.1 | plasmid replication initiator RepA | - |
| NQ150_RS27290 (NQ150_27290) | 42217..42309 | + | 93 | Protein_61 | hypothetical protein | - |
| NQ150_RS27295 (NQ150_27295) | 42472..43035 | + | 564 | WP_001523082.1 | serine acetyltransferase | - |
| NQ150_RS27300 (NQ150_27300) | 42999..43616 | - | 618 | WP_001523080.1 | tail fiber assembly protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..49150 | 49150 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13545.51 Da Isoelectric Point: 8.8337
>T262281 WP_000269912.1 NZ_CP109878:c39565-39218 [Escherichia coli]
MWTVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK
MWTVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|