Detailed information of TA system TA262279

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 32515..32941
• Replicon: plasmid pEC488-3
• Accession: NZ_CP109877
• Organism: Escherichia coli strain EC488

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NQ150_RS26760
• Protein ID: WP_001372321.1
• Coordinates: 32816..32941 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	32515..32739 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NQ150_RS26720 (27732)	27732..27992	+	261	WP_071600428.1	hypothetical protein	-
NQ150_RS26725 (28465)	28465..28992	+	528	WP_000290816.1	single-stranded DNA-binding protein	-
NQ150_RS26730 (29048)	29048..29281	+	234	WP_000005973.1	DUF905 domain-containing protein	-
NQ150_RS26735 (29340)	29340..31298	+	1959	WP_059514200.1	ParB/RepB/Spo0J family partition protein	-
NQ150_RS26740 (31353)	31353..31787	+	435	WP_059514203.1	conjugation system SOS inhibitor PsiB	-
NQ150_RS26745 (31784)	31784..32546	+	763	Protein_38	plasmid SOS inhibition protein A	-
NQ150_RS26750 (32515)	32515..32703	-	189	WP_001299721.1	hypothetical protein	-
- (32672)	32672..32737	+	66	NuclAT_1	-	-
- (32672)	32672..32737	-	66	NuclAT_0	-	-
- (32515)	32515..32739	+	225	NuclAT_0	-	Antitoxin
- (32515)	32515..32739	+	225	NuclAT_0	-	Antitoxin
- (32515)	32515..32739	+	225	NuclAT_0	-	Antitoxin
- (32515)	32515..32739	+	225	NuclAT_0	-	Antitoxin
- (32515)	32515..32739	-	225	NuclAT_0	-	-
NQ150_RS26755 (32725)	32725..32874	+	150	Protein_40	plasmid maintenance protein Mok	-
NQ150_RS26760 (32816)	32816..32941	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NQ150_RS26765 (33161)	33161..33391	+	231	WP_001426396.1	hypothetical protein	-
NQ150_RS26770 (33389)	33389..33562	-	174	Protein_43	hypothetical protein	-
NQ150_RS26775 (33632)	33632..33838	+	207	WP_000547968.1	hypothetical protein	-
NQ150_RS26780 (33863)	33863..34150	+	288	WP_000107548.1	hypothetical protein	-
NQ150_RS26785 (34272)	34272..35093	+	822	WP_052953840.1	DUF932 domain-containing protein	-
NQ150_RS26790 (35390)	35390..35992	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NQ150_RS26795 (36313)	36313..36696	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NQ150_RS26800 (36883)	36883..37572	+	690	WP_000283380.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T262279 WP_001372321.1 NZ_CP109877:32816-32941 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT262279 NZ_CP109877:32515-32739 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin