Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 39658..39922 Replicon plasmid pEC488-KPC-2
Accession NZ_CP109876
Organism Escherichia coli strain EC488

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NQ150_RS26085 Protein ID WP_001387489.1
Coordinates 39770..39922 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 39658..39718 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ150_RS26070 (35760) 35760..36830 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
NQ150_RS26075 (36849) 36849..38057 - 1209 WP_001303305.1 IncI1-type conjugal transfer protein TrbA -
NQ150_RS26080 (38364) 38364..39449 - 1086 WP_000080543.1 protein finQ -
- (39658) 39658..39718 - 61 NuclAT_0 - Antitoxin
- (39658) 39658..39718 - 61 NuclAT_0 - Antitoxin
- (39658) 39658..39718 - 61 NuclAT_0 - Antitoxin
- (39658) 39658..39718 - 61 NuclAT_0 - Antitoxin
NQ150_RS26085 (39770) 39770..39922 + 153 WP_001387489.1 Hok/Gef family protein Toxin
NQ150_RS26090 (39975) 39975..40244 - 270 WP_261630079.1 hypothetical protein -
NQ150_RS26095 (40544) 40544..40840 + 297 WP_011264046.1 DinQ-like type I toxin DqlB -
NQ150_RS26100 (40905) 40905..41081 - 177 WP_001054897.1 hypothetical protein -
NQ150_RS26105 (41473) 41473..41682 + 210 WP_000062602.1 HEAT repeat domain-containing protein -
NQ150_RS26110 (41754) 41754..42416 - 663 WP_000644797.1 plasmid IncI1-type surface exclusion protein ExcA -
NQ150_RS26115 (42487) 42487..44655 - 2169 WP_015508354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 - 1..126200 126200


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T262275 WP_001387489.1 NZ_CP109876:39770-39922 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT262275 NZ_CP109876:c39718-39658 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References