Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78534..78828 | Replicon | plasmid pEC488-1 |
| Accession | NZ_CP109875 | ||
| Organism | Escherichia coli strain EC488 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NQ150_RS25525 | Protein ID | WP_001372321.1 |
| Coordinates | 78534..78659 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 78736..78828 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ150_RS25480 (73895) | 73895..74179 | - | 285 | WP_001617873.1 | type-F conjugative transfer system pilin chaperone TraQ | - |
| NQ150_RS25485 (74306) | 74306..74626 | - | 321 | WP_001348757.1 | conjugal transfer protein TrbA | - |
| NQ150_RS25495 (75486) | 75486..76088 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| NQ150_RS25500 (76385) | 76385..77206 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| NQ150_RS25505 (77325) | 77325..77612 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| NQ150_RS25510 (77637) | 77637..77843 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| NQ150_RS25515 (77913) | 77913..78086 | + | 174 | Protein_101 | hypothetical protein | - |
| NQ150_RS25520 (78084) | 78084..78314 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| NQ150_RS25525 (78534) | 78534..78659 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NQ150_RS25530 (78601) | 78601..78750 | - | 150 | Protein_104 | plasmid maintenance protein Mok | - |
| - (78736) | 78736..78828 | - | 93 | NuclAT_1 | - | Antitoxin |
| - (78736) | 78736..78828 | - | 93 | NuclAT_1 | - | Antitoxin |
| - (78736) | 78736..78828 | - | 93 | NuclAT_1 | - | Antitoxin |
| - (78736) | 78736..78828 | - | 93 | NuclAT_1 | - | Antitoxin |
| - (80270) | 80270..80372 | - | 103 | NuclAT_0 | - | - |
| - (80270) | 80270..80372 | - | 103 | NuclAT_0 | - | - |
| - (80270) | 80270..80372 | - | 103 | NuclAT_0 | - | - |
| - (80270) | 80270..80372 | - | 103 | NuclAT_0 | - | - |
| NQ150_RS25540 (80341) | 80341..81103 | - | 763 | Protein_106 | plasmid SOS inhibition protein A | - |
| NQ150_RS25545 (81100) | 81100..81534 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| NQ150_RS25550 (81589) | 81589..83547 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..133748 | 133748 | |
| - | inside | IScluster/Tn | - | - | 74674..80224 | 5550 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T262268 WP_001372321.1 NZ_CP109875:c78659-78534 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 93 bp
>AT262268 NZ_CP109875:c78828-78736 [Escherichia coli]
TTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTAT
GTCTAGTCCACAT
TTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTAT
GTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|