Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4952104..4952706 | Replicon | chromosome |
| Accession | NZ_CP109874 | ||
| Organism | Escherichia coli strain EC488 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NQ150_RS23940 | Protein ID | WP_000897305.1 |
| Coordinates | 4952395..4952706 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NQ150_RS23935 | Protein ID | WP_000356397.1 |
| Coordinates | 4952104..4952394 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ150_RS23915 (4948606) | 4948606..4949508 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NQ150_RS23920 (4949505) | 4949505..4950140 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NQ150_RS23925 (4950137) | 4950137..4951066 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| NQ150_RS23930 (4951281) | 4951281..4951499 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
| NQ150_RS23935 (4952104) | 4952104..4952394 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NQ150_RS23940 (4952395) | 4952395..4952706 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NQ150_RS23945 (4952935) | 4952935..4953843 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
| NQ150_RS23950 (4953907) | 4953907..4954848 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NQ150_RS23955 (4954893) | 4954893..4955330 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NQ150_RS23960 (4955327) | 4955327..4956199 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NQ150_RS23965 (4956193) | 4956193..4956792 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| NQ150_RS23970 (4956891) | 4956891..4957676 | - | 786 | WP_000059679.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T262266 WP_000897305.1 NZ_CP109874:c4952706-4952395 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|