Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3936455..3937149 | Replicon | chromosome |
| Accession | NZ_CP109874 | ||
| Organism | Escherichia coli strain EC488 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | NQ150_RS19025 | Protein ID | WP_001263491.1 |
| Coordinates | 3936455..3936853 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | NQ150_RS19030 | Protein ID | WP_000554755.1 |
| Coordinates | 3936856..3937149 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ150_RS18995 (3931717) | 3931717..3933174 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
| NQ150_RS19000 (3933183) | 3933183..3933464 | + | 282 | WP_022645226.1 | hypothetical protein | - |
| NQ150_RS19005 (3933481) | 3933481..3933990 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
| NQ150_RS19010 (3934052) | 3934052..3934666 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
| NQ150_RS19015 (3934663) | 3934663..3935802 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
| NQ150_RS19020 (3935993) | 3935993..3936445 | - | 453 | WP_261630064.1 | GNAT family N-acetyltransferase | - |
| NQ150_RS19025 (3936455) | 3936455..3936853 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NQ150_RS19030 (3936856) | 3936856..3937149 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NQ150_RS19035 (3937201) | 3937201..3938256 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
| NQ150_RS19040 (3938327) | 3938327..3939112 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
| NQ150_RS19045 (3939084) | 3939084..3940796 | + | 1713 | Protein_3732 | flagellar biosynthesis protein FlhA | - |
| NQ150_RS19050 (3940894) | 3940894..3941667 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
| NQ150_RS19055 (3941853) | 3941853..3942113 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T262255 WP_001263491.1 NZ_CP109874:c3936853-3936455 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |