Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 618367..619166 | Replicon | chromosome |
Accession | NZ_CP109874 | ||
Organism | Escherichia coli strain EC488 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | NQ150_RS02970 | Protein ID | WP_000347273.1 |
Coordinates | 618367..618831 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | D6JF08 |
Locus tag | NQ150_RS02975 | Protein ID | WP_001308975.1 |
Coordinates | 618831..619166 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ150_RS02940 (613368) | 613368..613802 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NQ150_RS02945 (613820) | 613820..614698 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NQ150_RS02950 (614688) | 614688..615467 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NQ150_RS02955 (615478) | 615478..615951 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NQ150_RS02960 (615974) | 615974..617254 | - | 1281 | WP_023908831.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NQ150_RS02965 (617503) | 617503..618312 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NQ150_RS02970 (618367) | 618367..618831 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NQ150_RS02975 (618831) | 618831..619166 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NQ150_RS02980 (619315) | 619315..620886 | - | 1572 | WP_023908830.1 | galactarate dehydratase | - |
NQ150_RS02985 (621261) | 621261..622595 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
NQ150_RS02990 (622611) | 622611..623381 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T262241 WP_000347273.1 NZ_CP109874:c618831-618367 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|