Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5268560..5269155 | Replicon | chromosome |
Accession | NZ_CP109856 | ||
Organism | Pseudomonas aeruginosa strain PALA53 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA53_RS24385 | Protein ID | WP_003117425.1 |
Coordinates | 5268877..5269155 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA53_RS24380 | Protein ID | WP_003113527.1 |
Coordinates | 5268560..5268865 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA53_RS24360 (PALA53_04856) | 5264708..5265085 | + | 378 | WP_236080760.1 | ATP-binding protein | - |
PALA53_RS24365 (PALA53_04857) | 5265254..5266117 | - | 864 | WP_095396918.1 | integrase domain-containing protein | - |
PALA53_RS24370 (PALA53_04858) | 5266719..5267876 | - | 1158 | WP_170949710.1 | STY4528 family pathogenicity island replication protein | - |
PALA53_RS24380 (PALA53_04860) | 5268560..5268865 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
PALA53_RS24385 | 5268877..5269155 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA53_RS24390 | 5269208..5269336 | - | 129 | Protein_4818 | integrase | - |
PALA53_RS24395 (PALA53_04861) | 5269484..5271712 | + | 2229 | WP_095396920.1 | TonB-dependent receptor | - |
PALA53_RS24400 (PALA53_04862) | 5271782..5272429 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA53_RS24405 (PALA53_04863) | 5272491..5273729 | - | 1239 | WP_019681675.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T262236 WP_003117425.1 NZ_CP109856:c5269155-5268877 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|