Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 640375..641032 | Replicon | plasmid pESL4.1 |
| Accession | NZ_CP109854 | ||
| Organism | Pantoea dispersa strain ESL4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OH655_RS22115 | Protein ID | WP_181444762.1 |
| Coordinates | 640697..641032 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OH655_RS22110 | Protein ID | WP_104187608.1 |
| Coordinates | 640375..640671 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH655_RS22075 (OH655_22075) | 635508..635639 | + | 132 | WP_255412114.1 | hypothetical protein | - |
| OH655_RS22080 (OH655_22080) | 635641..636573 | - | 933 | WP_021508860.1 | AraC family transcriptional regulator | - |
| OH655_RS22085 (OH655_22085) | 636734..637468 | + | 735 | WP_058758975.1 | SDR family oxidoreductase | - |
| OH655_RS22090 (OH655_22090) | 637546..638514 | - | 969 | WP_021508858.1 | magnesium/cobalt transporter CorA | - |
| OH655_RS22095 (OH655_22095) | 638611..638931 | - | 321 | WP_021508856.1 | AzlD domain-containing protein | - |
| OH655_RS22100 (OH655_22100) | 638921..639595 | - | 675 | WP_021508855.1 | AzlC family ABC transporter permease | - |
| OH655_RS22105 (OH655_22105) | 639698..640246 | + | 549 | WP_021508854.1 | XRE family transcriptional regulator | - |
| OH655_RS22110 (OH655_22110) | 640375..640671 | - | 297 | WP_104187608.1 | NadS family protein | Antitoxin |
| OH655_RS22115 (OH655_22115) | 640697..641032 | - | 336 | WP_181444762.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OH655_RS22120 (OH655_22120) | 641224..641745 | + | 522 | WP_264444242.1 | GNAT family N-acetyltransferase | - |
| OH655_RS22125 (OH655_22125) | 641742..643142 | - | 1401 | WP_264444745.1 | ATP-binding cassette domain-containing protein | - |
| OH655_RS22130 (OH655_22130) | 643142..643918 | - | 777 | WP_215481411.1 | ABC transporter permease subunit | - |
| OH655_RS22135 (OH655_22135) | 643921..644856 | - | 936 | WP_058758969.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | iroN | 1..690879 | 690879 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12827.77 Da Isoelectric Point: 9.3931
>T262231 WP_181444762.1 NZ_CP109854:c641032-640697 [Pantoea dispersa]
VTGNYLEFIETRVFSKARQSLLADDQEFQELQIFLLEHHELGDTISQTGGCKKIRWSRAGMGKRGGTRIIYYTRLSSGRI
YLLLIYPKNVKDDLNEAEKALLKVFTQQMNL
VTGNYLEFIETRVFSKARQSLLADDQEFQELQIFLLEHHELGDTISQTGGCKKIRWSRAGMGKRGGTRIIYYTRLSSGRI
YLLLIYPKNVKDDLNEAEKALLKVFTQQMNL
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|