Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 569131..569785 | Replicon | plasmid pESL4.1 |
Accession | NZ_CP109854 | ||
Organism | Pantoea dispersa strain ESL4 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OH655_RS21715 | Protein ID | WP_021508927.1 |
Coordinates | 569131..569502 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A246NDM6 |
Locus tag | OH655_RS21720 | Protein ID | WP_021508926.1 |
Coordinates | 569486..569785 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH655_RS21695 (OH655_21695) | 564406..565785 | + | 1380 | WP_264444144.1 | heavy metal sensor histidine kinase | - |
OH655_RS21700 (OH655_21700) | 565823..566476 | - | 654 | WP_058770319.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
OH655_RS21705 (OH655_21705) | 566581..567582 | - | 1002 | WP_264444146.1 | zinc-binding alcohol dehydrogenase family protein | - |
OH655_RS21710 (OH655_21710) | 567719..568636 | + | 918 | WP_058759023.1 | LysR family transcriptional regulator | - |
OH655_RS21715 (OH655_21715) | 569131..569502 | + | 372 | WP_021508927.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH655_RS21720 (OH655_21720) | 569486..569785 | + | 300 | WP_021508926.1 | XRE family transcriptional regulator | Antitoxin |
OH655_RS21725 (OH655_21725) | 569863..570330 | - | 468 | WP_058759022.1 | hypothetical protein | - |
OH655_RS21730 (OH655_21730) | 570516..571445 | - | 930 | WP_059009262.1 | ABC transporter substrate-binding protein | - |
OH655_RS21735 (OH655_21735) | 571455..572189 | - | 735 | WP_264444154.1 | ABC transporter permease | - |
OH655_RS21740 (OH655_21740) | 572173..572889 | - | 717 | WP_215788040.1 | ABC transporter ATP-binding protein | - |
OH655_RS21745 (OH655_21745) | 572886..573854 | - | 969 | WP_021508921.1 | HesA/MoeB/ThiF family protein | - |
OH655_RS21750 (OH655_21750) | 573865..574623 | - | 759 | WP_010615680.1 | thiazole synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..690879 | 690879 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14423.65 Da Isoelectric Point: 10.3873
>T262229 WP_021508927.1 NZ_CP109854:569131-569502 [Pantoea dispersa]
VWQVEATDRFWKWLQAQDEALRLDVLAAMKLLAQYGPHLGRPFVDTLMLSRVPNMKELRVQSKGRPIRSFFVFDPRRHAI
VLCAGNKQGKNQKRFYQQMLRIAETEYHHHLNAIGETHNENLG
VWQVEATDRFWKWLQAQDEALRLDVLAAMKLLAQYGPHLGRPFVDTLMLSRVPNMKELRVQSKGRPIRSFFVFDPRRHAI
VLCAGNKQGKNQKRFYQQMLRIAETEYHHHLNAIGETHNENLG
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|