Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 168428..169108 | Replicon | chromosome |
| Accession | NZ_CP109853 | ||
| Organism | Pantoea dispersa strain ESL4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A246NHY2 |
| Locus tag | OH655_RS00755 | Protein ID | WP_059013049.1 |
| Coordinates | 168428..168727 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A246NHX0 |
| Locus tag | OH655_RS00760 | Protein ID | WP_058775157.1 |
| Coordinates | 168776..169108 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH655_RS00740 (OH655_00740) | 164755..165249 | + | 495 | WP_058775154.1 | GNAT family N-acetyltransferase | - |
| OH655_RS00745 (OH655_00745) | 165624..166538 | - | 915 | WP_021507882.1 | sugar ABC transporter substrate-binding protein | - |
| OH655_RS00750 (OH655_00750) | 166974..168368 | + | 1395 | WP_058775155.1 | MFS transporter | - |
| OH655_RS00755 (OH655_00755) | 168428..168727 | + | 300 | WP_059013049.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OH655_RS00760 (OH655_00760) | 168776..169108 | + | 333 | WP_058775157.1 | HigA family addiction module antitoxin | Antitoxin |
| OH655_RS00765 (OH655_00765) | 169200..170363 | + | 1164 | WP_021507880.1 | HD-GYP domain-containing protein | - |
| OH655_RS00770 (OH655_00770) | 170472..170561 | + | 90 | WP_021507879.1 | K(+)-transporting ATPase subunit F | - |
| OH655_RS00775 (OH655_00775) | 170561..172240 | + | 1680 | WP_264441873.1 | potassium-transporting ATPase subunit KdpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11503.22 Da Isoelectric Point: 10.4912
>T262219 WP_059013049.1 NZ_CP109853:168428-168727 [Pantoea dispersa]
MGSIRAFRQAWLAQFYTHGTPHAQIPRAIESALARKLDIIHAATSHQDLRSPPGNRFEALKPPLLGYYSIRVNAQYRLIF
QWAKGEAWDLYLDPHRYKK
MGSIRAFRQAWLAQFYTHGTPHAQIPRAIESALARKLDIIHAATSHQDLRSPPGNRFEALKPPLLGYYSIRVNAQYRLIF
QWAKGEAWDLYLDPHRYKK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246NHY2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246NHX0 |