Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5398033..5398628 | Replicon | chromosome |
Accession | NZ_CP109851 | ||
Organism | Pseudomonas aeruginosa strain PALA51 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA51_RS25505 | Protein ID | WP_003117425.1 |
Coordinates | 5398350..5398628 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA51_RS25500 | Protein ID | WP_003113527.1 |
Coordinates | 5398033..5398338 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA51_RS25470 | 5393638..5393973 | + | 336 | WP_025921265.1 | hypothetical protein | - |
PALA51_RS25475 | 5393983..5394372 | + | 390 | WP_025921264.1 | (deoxy)nucleoside triphosphate pyrophosphohydrolase | - |
PALA51_RS25480 (PALA51_05051) | 5394452..5395183 | + | 732 | WP_079384296.1 | HNH endonuclease | - |
PALA51_RS25485 (PALA51_05052) | 5395263..5396246 | - | 984 | WP_079384298.1 | anti-phage protein KwaB | - |
PALA51_RS25490 (PALA51_05053) | 5396243..5396833 | - | 591 | WP_079384299.1 | anti-phage protein KwaA | - |
PALA51_RS25495 | 5397283..5397696 | - | 414 | WP_052150791.1 | hypothetical protein | - |
PALA51_RS25500 (PALA51_05054) | 5398033..5398338 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
PALA51_RS25505 | 5398350..5398628 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA51_RS25510 | 5398681..5398809 | - | 129 | Protein_5039 | integrase | - |
PALA51_RS25515 (PALA51_05055) | 5398957..5401185 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PALA51_RS25520 (PALA51_05056) | 5401255..5401902 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA51_RS25525 (PALA51_05057) | 5401964..5403202 | - | 1239 | WP_003117424.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T262218 WP_003117425.1 NZ_CP109851:c5398628-5398350 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|