Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5867515..5868110 | Replicon | chromosome |
Accession | NZ_CP109849 | ||
Organism | Pseudomonas aeruginosa strain PALA34 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA34_RS27540 | Protein ID | WP_003117425.1 |
Coordinates | 5867832..5868110 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA34_RS27535 | Protein ID | WP_003099268.1 |
Coordinates | 5867515..5867820 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA34_RS27505 (PALA34_05442) | 5862968..5863258 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
PALA34_RS27510 (PALA34_05443) | 5863470..5863742 | - | 273 | WP_003115921.1 | hypothetical protein | - |
PALA34_RS27515 (PALA34_05444) | 5863852..5864118 | + | 267 | WP_016852153.1 | hypothetical protein | - |
PALA34_RS27520 (PALA34_05445) | 5864250..5865086 | + | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
PALA34_RS27525 (PALA34_05446) | 5865061..5866599 | + | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
PALA34_RS27530 | 5866611..5867138 | - | 528 | WP_071535723.1 | ATP-binding protein | - |
PALA34_RS27535 (PALA34_05447) | 5867515..5867820 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA34_RS27540 | 5867832..5868110 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA34_RS27545 | 5868163..5868291 | - | 129 | Protein_5446 | integrase | - |
PALA34_RS27550 (PALA34_05448) | 5868439..5870667 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
PALA34_RS27555 (PALA34_05449) | 5870737..5871384 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA34_RS27560 (PALA34_05450) | 5871446..5872684 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T262204 WP_003117425.1 NZ_CP109849:c5868110-5867832 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|