Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5918842..5919437 | Replicon | chromosome |
| Accession | NZ_CP109845 | ||
| Organism | Pseudomonas aeruginosa strain PALA33 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA33_RS28035 | Protein ID | WP_003113526.1 |
| Coordinates | 5919159..5919437 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA33_RS28030 | Protein ID | WP_003113527.1 |
| Coordinates | 5918842..5919147 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA33_RS28010 | 5914316..5914651 | + | 336 | WP_031633682.1 | hypothetical protein | - |
| PALA33_RS28015 (PALA33_05544) | 5915183..5916949 | - | 1767 | WP_023087829.1 | anti-phage dCTP deaminase | - |
| PALA33_RS28020 (PALA33_05545) | 5917206..5917868 | - | 663 | WP_023087830.1 | restriction endonuclease | - |
| PALA33_RS28025 | 5918092..5918505 | - | 414 | WP_049231965.1 | hypothetical protein | - |
| PALA33_RS28030 (PALA33_05546) | 5918842..5919147 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA33_RS28035 | 5919159..5919437 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA33_RS28040 | 5919490..5919618 | - | 129 | Protein_5545 | integrase | - |
| PALA33_RS28045 (PALA33_05547) | 5919766..5921994 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| PALA33_RS28050 (PALA33_05548) | 5922064..5922711 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA33_RS28055 (PALA33_05549) | 5922773..5924011 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T262192 WP_003113526.1 NZ_CP109845:c5919437-5919159 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|