Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) prlF-yhaV (relBE)/YhaV-PrlF
Location 2856645..2857420 Replicon chromosome
Accession NZ_CP109845
Organism Pseudomonas aeruginosa strain PALA33

Toxin (Protein)


Gene name yhaV Uniprot ID V6ADY6
Locus tag PALA33_RS13555 Protein ID WP_009518525.1
Coordinates 2856962..2857420 (+) Length 153 a.a.

Antitoxin (Protein)


Gene name prlF Uniprot ID A0A7M2ZSF3
Locus tag PALA33_RS13550 Protein ID WP_023087286.1
Coordinates 2856645..2856962 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA33_RS13520 (PALA33_02673) 2851969..2852619 - 651 WP_023087281.1 isoprenylcysteine carboxylmethyltransferase family protein -
PALA33_RS13525 (PALA33_02674) 2852616..2852855 - 240 WP_023087282.1 DUF2933 domain-containing protein -
PALA33_RS13530 (PALA33_02675) 2852867..2853268 - 402 WP_023087283.1 hypothetical protein -
PALA33_RS13535 2853423..2853857 - 435 WP_078452152.1 hypothetical protein -
PALA33_RS13540 (PALA33_02676) 2853930..2854424 + 495 WP_031633853.1 MerR family DNA-binding protein -
PALA33_RS13545 (PALA33_02677) 2854480..2856345 - 1866 WP_023087285.1 MobH family relaxase -
PALA33_RS13550 (PALA33_02678) 2856645..2856962 + 318 WP_023087286.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
PALA33_RS13555 (PALA33_02679) 2856962..2857420 + 459 WP_009518525.1 type II toxin-antitoxin system YhaV family toxin Toxin
PALA33_RS13560 (PALA33_02680) 2857447..2857806 + 360 WP_023087287.1 DUF3742 family protein -
PALA33_RS13565 (PALA33_02681) 2857813..2859336 - 1524 WP_023087288.1 conjugal transfer protein TraG N-terminal domain-containing protein -
PALA33_RS13570 (PALA33_02682) 2859350..2859709 - 360 WP_023087289.1 hypothetical protein -
PALA33_RS13575 (PALA33_02683) 2859706..2861100 - 1395 WP_023087290.1 integrating conjugative element protein -
PALA33_RS13580 (PALA33_02684) 2861110..2862057 - 948 WP_023087291.1 TIGR03756 family integrating conjugative element protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2803349..2918565 115216


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin endonuclease, YhaV

(8-144)

Antitoxin

PrlF antitoxin

(8-100)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 17660.02 Da        Isoelectric Point: 10.1848

>T262188 WP_009518525.1 NZ_CP109845:2856962-2857420 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE

Download         Length: 459 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11156.69 Da        Isoelectric Point: 4.5685

>AT262188 WP_023087286.1 NZ_CP109845:2856645-2856962 [Pseudomonas aeruginosa]
MPAIHEVATLTSKGQITLPKPIRQALGVDAGGKLAFDLRGSEVVVTRVDAEHEDPAIGAFLSLLARDIEAGRNLQGLPED
LARAMLEHAGHGVNLDEEIDGKVEL

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V6ADY6

Antitoxin

Source ID Structure
AlphaFold DB A0A7M2ZSF3

References