Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5527268..5527863 | Replicon | chromosome |
| Accession | NZ_CP109844 | ||
| Organism | Pseudomonas aeruginosa strain PALA32 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA32_RS25755 | Protein ID | WP_003113526.1 |
| Coordinates | 5527585..5527863 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA32_RS25750 | Protein ID | WP_003099268.1 |
| Coordinates | 5527268..5527573 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA32_RS25735 (PALA32_05094) | 5523998..5524687 | - | 690 | WP_128725157.1 | hypothetical protein | - |
| PALA32_RS25740 (PALA32_05095) | 5524684..5525961 | - | 1278 | WP_128725156.1 | hypothetical protein | - |
| PALA32_RS25745 (PALA32_05096) | 5526102..5526761 | - | 660 | WP_128725155.1 | hypothetical protein | - |
| PALA32_RS25750 (PALA32_05097) | 5527268..5527573 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA32_RS25755 | 5527585..5527863 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA32_RS25760 | 5527916..5528044 | - | 129 | Protein_5090 | integrase | - |
| PALA32_RS25765 (PALA32_05098) | 5528192..5530420 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| PALA32_RS25770 (PALA32_05099) | 5530490..5531137 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA32_RS25775 (PALA32_05100) | 5531199..5532437 | - | 1239 | WP_019681675.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T262185 WP_003113526.1 NZ_CP109844:c5527863-5527585 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|