Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5667837..5668432 | Replicon | chromosome |
Accession | NZ_CP109843 | ||
Organism | Pseudomonas aeruginosa strain PALA29 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA29_RS27190 | Protein ID | WP_003117425.1 |
Coordinates | 5668154..5668432 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA29_RS27185 | Protein ID | WP_003113527.1 |
Coordinates | 5667837..5668142 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA29_RS27150 (PALA29_05359) | 5662976..5663824 | + | 849 | WP_023114865.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PALA29_RS27160 | 5663991..5664932 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA29_RS27165 (PALA29_05361) | 5665049..5665663 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA29_RS27170 (PALA29_05362) | 5665705..5666289 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA29_RS27175 (PALA29_05363) | 5666330..5667430 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA29_RS27185 (PALA29_05365) | 5667837..5668142 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
PALA29_RS27190 | 5668154..5668432 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA29_RS27195 | 5668485..5668613 | - | 129 | Protein_5371 | integrase | - |
PALA29_RS27200 (PALA29_05366) | 5668761..5670989 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PALA29_RS27205 (PALA29_05367) | 5671059..5671706 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA29_RS27210 (PALA29_05368) | 5671768..5673006 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T262179 WP_003117425.1 NZ_CP109843:c5668432-5668154 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|