Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 25723..26381 Replicon plasmid pZ198-1
Accession NZ_CP109837
Organism Acinetobacter baumannii strain Z198

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OHJ24_RS20115 Protein ID WP_000312250.1
Coordinates 26022..26381 (-) Length 120 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OHJ24_RS20110 Protein ID WP_001096429.1
Coordinates 25723..26022 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHJ24_RS20065 (OHJ24_20075) 20758..21015 + 258 WP_000834292.1 hypothetical protein -
OHJ24_RS20070 (OHJ24_20080) 21020..21592 + 573 WP_038345812.1 hypothetical protein -
OHJ24_RS20075 (OHJ24_20085) 21568..21747 + 180 WP_002081921.1 hypothetical protein -
OHJ24_RS20080 (OHJ24_20090) 21764..22393 + 630 WP_002081923.1 hypothetical protein -
OHJ24_RS20085 (OHJ24_20095) 22433..22942 + 510 WP_001043199.1 hypothetical protein -
OHJ24_RS20090 (OHJ24_20100) 23023..23577 + 555 WP_038345807.1 hypothetical protein -
OHJ24_RS20095 (OHJ24_20105) 23627..24163 + 537 WP_000731981.1 hypothetical protein -
OHJ24_RS20100 (OHJ24_20110) 24784..25266 + 483 WP_001052677.1 hypothetical protein -
OHJ24_RS20105 (OHJ24_20115) 25359..25622 - 264 WP_000110863.1 hypothetical protein -
OHJ24_RS20110 (OHJ24_20120) 25723..26022 - 300 WP_001096429.1 XRE family transcriptional regulator Antitoxin
OHJ24_RS20115 (OHJ24_20125) 26022..26381 - 360 WP_000312250.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OHJ24_RS20120 (OHJ24_20130) 26582..27148 + 567 WP_000710385.1 hypothetical protein -
OHJ24_RS20125 (OHJ24_20135) 27197..27379 + 183 WP_000373385.1 hypothetical protein -
OHJ24_RS20130 (OHJ24_20140) 27446..28144 + 699 WP_000873188.1 hypothetical protein -
OHJ24_RS20135 (OHJ24_20145) 28283..28666 + 384 WP_000654348.1 hypothetical protein -
OHJ24_RS20140 (OHJ24_20150) 28733..29491 + 759 WP_001053128.1 hypothetical protein -
OHJ24_RS20145 (OHJ24_20155) 29543..29878 + 336 WP_000653925.1 hypothetical protein -
OHJ24_RS20150 (OHJ24_20160) 30745..31059 + 315 WP_000708715.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..72256 72256


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(14-109)

Antitoxin

HigA2-like, helix-turn-helix domain

(12-88)


Sequences

Toxin        


Download         Length: 120 a.a.        Molecular weight: 13751.62 Da        Isoelectric Point: 4.8212

>T262168 WP_000312250.1 NZ_CP109837:c26381-26022 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK

Download         Length: 360 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11012.93 Da        Isoelectric Point: 10.4856

>AT262168 WP_001096429.1 NZ_CP109837:c26022-25723 [Acinetobacter baumannii]
MAKLNDIISKRSPESQQRIKKMANQMLLDINLSNLREELKISQAEIAKNLGVSQAAISKREKLGKDLKISSLKEYVEAMG
GKVRLDVELPNGKHVAISI

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References