Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5672250..5672845 | Replicon | chromosome |
Accession | NZ_CP109835 | ||
Organism | Pseudomonas aeruginosa strain PALA26 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PALA26_RS26540 | Protein ID | WP_003113526.1 |
Coordinates | 5672567..5672845 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA26_RS26535 | Protein ID | WP_003133769.1 |
Coordinates | 5672250..5672555 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA26_RS26500 (PALA26_05241) | 5667391..5668239 | + | 849 | WP_003095007.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PALA26_RS26510 (PALA26_05243) | 5668406..5669347 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA26_RS26515 (PALA26_05244) | 5669464..5670078 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA26_RS26520 (PALA26_05245) | 5670120..5670704 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA26_RS26525 (PALA26_05246) | 5670745..5671845 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA26_RS26535 (PALA26_05248) | 5672250..5672555 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
PALA26_RS26540 | 5672567..5672845 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA26_RS26545 | 5672898..5673026 | - | 129 | Protein_5244 | integrase | - |
PALA26_RS26550 (PALA26_05249) | 5673174..5675402 | + | 2229 | WP_003141628.1 | TonB-dependent receptor | - |
PALA26_RS26555 (PALA26_05250) | 5675472..5676119 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA26_RS26560 (PALA26_05251) | 5676181..5677419 | - | 1239 | WP_003141631.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T262165 WP_003113526.1 NZ_CP109835:c5672845-5672567 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|