Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5265397..5265992 | Replicon | chromosome |
| Accession | NZ_CP109834 | ||
| Organism | Pseudomonas aeruginosa strain PALA25 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | PALA25_RS24395 | Protein ID | WP_003117425.1 |
| Coordinates | 5265714..5265992 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA25_RS24390 | Protein ID | WP_003113527.1 |
| Coordinates | 5265397..5265702 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA25_RS24370 (PALA25_04861) | 5261545..5261922 | + | 378 | WP_236080760.1 | ATP-binding protein | - |
| PALA25_RS24375 (PALA25_04862) | 5262091..5262954 | - | 864 | WP_095396918.1 | integrase domain-containing protein | - |
| PALA25_RS24380 (PALA25_04863) | 5263556..5264713 | - | 1158 | WP_170949710.1 | STY4528 family pathogenicity island replication protein | - |
| PALA25_RS24390 (PALA25_04865) | 5265397..5265702 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA25_RS24395 | 5265714..5265992 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA25_RS24400 | 5266045..5266173 | - | 129 | Protein_4818 | integrase | - |
| PALA25_RS24405 (PALA25_04866) | 5266321..5268549 | + | 2229 | WP_095396920.1 | TonB-dependent receptor | - |
| PALA25_RS24410 (PALA25_04867) | 5268619..5269266 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA25_RS24415 (PALA25_04868) | 5269328..5270566 | - | 1239 | WP_019681675.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T262158 WP_003117425.1 NZ_CP109834:c5265992-5265714 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|