Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5343882..5344477 | Replicon | chromosome |
| Accession | NZ_CP109833 | ||
| Organism | Pseudomonas aeruginosa strain PALA23 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA23_RS24790 | Protein ID | WP_003113526.1 |
| Coordinates | 5344199..5344477 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA23_RS24785 | Protein ID | WP_003133769.1 |
| Coordinates | 5343882..5344187 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA23_RS24755 | 5339252..5339524 | + | 273 | WP_071538125.1 | DNA-binding protein | - |
| PALA23_RS24760 | 5339582..5340163 | + | 582 | WP_123903235.1 | sce7726 family protein | - |
| PALA23_RS24765 (PALA23_04917) | 5340150..5341220 | - | 1071 | WP_023098928.1 | beta family protein | - |
| PALA23_RS24770 (PALA23_04918) | 5341210..5342046 | - | 837 | WP_079387117.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PALA23_RS24775 (PALA23_04919) | 5342039..5342713 | - | 675 | WP_023098926.1 | N-acetyltransferase | - |
| PALA23_RS24780 | 5343139..5343546 | - | 408 | WP_049267485.1 | hypothetical protein | - |
| PALA23_RS24785 (PALA23_04920) | 5343882..5344187 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA23_RS24790 | 5344199..5344477 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA23_RS24795 | 5344530..5344658 | - | 129 | Protein_4897 | integrase | - |
| PALA23_RS24800 (PALA23_04921) | 5344806..5347034 | + | 2229 | WP_043089846.1 | TonB-dependent receptor | - |
| PALA23_RS24805 (PALA23_04922) | 5347104..5347751 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA23_RS24810 (PALA23_04923) | 5347813..5349051 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10614.13 Da Isoelectric Point: 7.8937
>T262153 WP_003113526.1 NZ_CP109833:c5344477-5344199 [Pseudomonas aeruginosa]
VILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
VILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|