Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4246359..4247011 | Replicon | chromosome |
Accession | NZ_CP109824 | ||
Organism | Serratia marcescens strain SMBC31 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OHY99_RS20590 | Protein ID | WP_049206122.1 |
Coordinates | 4246359..4246703 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OHY99_RS20595 | Protein ID | WP_025304078.1 |
Coordinates | 4246709..4247011 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHY99_RS20580 (OHY99_20585) | 4242702..4244960 | - | 2259 | WP_261456825.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
OHY99_RS20585 (OHY99_20590) | 4245181..4246200 | + | 1020 | WP_028127674.1 | HTH-type transcriptional regulator GalR | - |
OHY99_RS20590 (OHY99_20595) | 4246359..4246703 | + | 345 | WP_049206122.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OHY99_RS20595 (OHY99_20600) | 4246709..4247011 | + | 303 | WP_025304078.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OHY99_RS20600 (OHY99_20605) | 4247039..4248301 | - | 1263 | WP_089196221.1 | diaminopimelate decarboxylase | - |
OHY99_RS20605 (OHY99_20610) | 4248435..4249358 | + | 924 | WP_043139803.1 | LysR family transcriptional regulator | - |
OHY99_RS20610 (OHY99_20615) | 4249386..4250294 | - | 909 | WP_049296173.1 | LysR family transcriptional regulator | - |
OHY99_RS20615 (OHY99_20620) | 4250403..4251287 | + | 885 | WP_025304082.1 | MBL fold metallo-hydrolase | - |
OHY99_RS20620 (OHY99_20625) | 4251356..4252003 | + | 648 | WP_043139796.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13283.28 Da Isoelectric Point: 10.8296
>T262141 WP_049206122.1 NZ_CP109824:4246359-4246703 [Serratia marcescens]
MWQVVTVERFDDWFLALNNAQQTSILAAIFKLQTFGPQLARPHADTLHFSDAARQLKELRVQHRGRPFRGFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIFKLQTFGPQLARPHADTLHFSDAARQLKELRVQHRGRPFRGFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|