Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3462265..3462925 | Replicon | chromosome |
Accession | NZ_CP109824 | ||
Organism | Serratia marcescens strain SMBC31 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A656VMD8 |
Locus tag | OHY99_RS16790 | Protein ID | WP_025303493.1 |
Coordinates | 3462572..3462925 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8G2G5Z5 |
Locus tag | OHY99_RS16785 | Protein ID | WP_016927038.1 |
Coordinates | 3462265..3462567 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHY99_RS16765 (OHY99_16765) | 3457742..3458656 | - | 915 | WP_004928592.1 | branched-chain amino acid ABC transporter permease | - |
OHY99_RS16770 (OHY99_16770) | 3458782..3459900 | - | 1119 | WP_016927040.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
OHY99_RS16780 (OHY99_16780) | 3460632..3461840 | - | 1209 | WP_213928418.1 | aldose 1-epimerase family protein | - |
OHY99_RS16785 (OHY99_16785) | 3462265..3462567 | - | 303 | WP_016927038.1 | XRE family transcriptional regulator | Antitoxin |
OHY99_RS16790 (OHY99_16790) | 3462572..3462925 | - | 354 | WP_025303493.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OHY99_RS16795 (OHY99_16795) | 3463364..3464659 | + | 1296 | WP_025303494.1 | MFS transporter | - |
OHY99_RS16800 (OHY99_16800) | 3464686..3465492 | + | 807 | WP_213928417.1 | substrate-binding domain-containing protein | - |
OHY99_RS16805 (OHY99_16805) | 3465467..3466366 | - | 900 | WP_197822133.1 | LysR family transcriptional regulator | - |
OHY99_RS16810 (OHY99_16810) | 3466470..3466835 | - | 366 | WP_004935528.1 | diacylglycerol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13548.47 Da Isoelectric Point: 9.0170
>T262138 WP_025303493.1 NZ_CP109824:c3462925-3462572 [Serratia marcescens]
VWEIKTTDAFDHWYRSLSDADRAGVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQCRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQVADREFTNWLNTLNEKE
VWEIKTTDAFDHWYRSLSDADRAGVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQCRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQVADREFTNWLNTLNEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|