Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-as-bsrE/- |
| Location | 2015021..2015233 | Replicon | chromosome |
| Accession | NZ_CP109795 | ||
| Organism | Bacillus velezensis strain B19 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | L0P93_RS10195 | Protein ID | WP_104679131.1 |
| Coordinates | 2015057..2015233 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrE | ||
| Locus tag | - | ||
| Coordinates | 2015021..2015116 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L0P93_RS10170 (2010041) | 2010041..2011915 | - | 1875 | Protein_1952 | hypothetical protein | - |
| L0P93_RS10175 (2011956) | 2011956..2012135 | - | 180 | WP_014417885.1 | hypothetical protein | - |
| L0P93_RS10180 (2012255) | 2012255..2012491 | - | 237 | WP_021493593.1 | helix-turn-helix domain-containing protein | - |
| L0P93_RS10185 (2012670) | 2012670..2012954 | + | 285 | WP_021493592.1 | hypothetical protein | - |
| L0P93_RS10190 (2012954) | 2012954..2014066 | + | 1113 | WP_014417886.1 | cell division protein FtsZ | - |
| - (2015021) | 2015021..2015116 | - | 96 | NuclAT_0 | - | Antitoxin |
| - (2015021) | 2015021..2015116 | - | 96 | NuclAT_0 | - | Antitoxin |
| - (2015021) | 2015021..2015116 | - | 96 | NuclAT_0 | - | Antitoxin |
| - (2015021) | 2015021..2015116 | - | 96 | NuclAT_0 | - | Antitoxin |
| L0P93_RS10195 (2015057) | 2015057..2015233 | + | 177 | WP_104679131.1 | hypothetical protein | Toxin |
| L0P93_RS10200 (2015252) | 2015252..2015502 | + | 251 | Protein_1958 | hypothetical protein | - |
| L0P93_RS10205 (2015547) | 2015547..2015705 | + | 159 | WP_069684683.1 | hypothetical protein | - |
| L0P93_RS10210 (2015793) | 2015793..2017010 | + | 1218 | WP_104679129.1 | hypothetical protein | - |
| L0P93_RS10215 (2017338) | 2017338..2017769 | + | 432 | WP_104679128.1 | hypothetical protein | - |
| L0P93_RS10220 (2018174) | 2018174..2018458 | + | 285 | WP_277161348.1 | hypothetical protein | - |
| L0P93_RS10225 (2018511) | 2018511..2018702 | + | 192 | WP_104679126.1 | hypothetical protein | - |
| L0P93_RS10230 (2018718) | 2018718..2019020 | + | 303 | WP_104679125.1 | hypothetical protein | - |
| L0P93_RS10235 (2019078) | 2019078..2019278 | + | 201 | WP_104679124.1 | hypothetical protein | - |
| L0P93_RS10240 (2019278) | 2019278..2019514 | + | 237 | WP_104679123.1 | hypothetical protein | - |
| L0P93_RS10245 (2019527) | 2019527..2019724 | + | 198 | WP_104679122.1 | hypothetical protein | - |
| L0P93_RS10250 (2019760) | 2019760..2020086 | + | 327 | WP_104679121.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1948172..2094514 | 146342 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6912.46 Da Isoelectric Point: 12.8833
>T262116 WP_104679131.1 NZ_CP109795:2015057-2015233 [Bacillus velezensis]
VFEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VFEKVGIIVAFLISLTVLTINSLTIVEKIRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 96 bp
>AT262116 NZ_CP109795:c2015116-2015021 [Bacillus velezensis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAACACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACA
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAACACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
