Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 811052..811779 | Replicon | chromosome |
| Accession | NZ_CP109775 | ||
| Organism | Shigella sonnei strain CIP_106347 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | OHN14_RS04140 | Protein ID | WP_000547563.1 |
| Coordinates | 811052..811363 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OHN14_RS04145 | Protein ID | WP_000126296.1 |
| Coordinates | 811360..811779 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OHN14_RS04110 (806206) | 806206..807903 | + | 1698 | WP_001288143.1 | formate hydrogenlyase subunit HycE | - |
| OHN14_RS04115 (807913) | 807913..808455 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| OHN14_RS04120 (808455) | 808455..809222 | + | 768 | WP_000067403.1 | formate hydrogenlyase subunit HycG | - |
| OHN14_RS04125 (809219) | 809219..809629 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| OHN14_RS04130 (809622) | 809622..810092 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| OHN14_RS04135 (810117) | 810117..810890 | + | 774 | WP_001026459.1 | hypothetical protein | - |
| OHN14_RS04140 (811052) | 811052..811363 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OHN14_RS04145 (811360) | 811360..811779 | + | 420 | WP_000126296.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OHN14_RS04150 (811893) | 811893..813317 | - | 1425 | WP_000110319.1 | 6-phospho-beta-glucosidase AscB | - |
| OHN14_RS04155 (813326) | 813326..814783 | - | 1458 | WP_001107890.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| OHN14_RS04160 (815043) | 815043..816053 | + | 1011 | WP_001402444.1 | DNA-binding transcriptional regulator AscG | - |
| OHN14_RS04165 (816201) | 816201..816728 | + | 528 | WP_001078766.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T262100 WP_000547563.1 NZ_CP109775:811052-811363 [Shigella sonnei]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.38 Da Isoelectric Point: 4.3653
>AT262100 WP_000126296.1 NZ_CP109775:811360-811779 [Shigella sonnei]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|