Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 544411..545138 | Replicon | chromosome |
Accession | NZ_CP109775 | ||
Organism | Shigella sonnei strain CIP_106347 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | OHN14_RS02820 | Protein ID | WP_000550189.1 |
Coordinates | 544824..545138 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OHN14_RS02815 | Protein ID | WP_000560263.1 |
Coordinates | 544411..544827 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHN14_RS02805 (539771) | 539771..542122 | + | 2352 | WP_000695471.1 | alpha-glucosidase | - |
OHN14_RS02810 (542348) | 542348..544366 | + | 2019 | WP_000121451.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
OHN14_RS02815 (544411) | 544411..544827 | - | 417 | WP_000560263.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
OHN14_RS02820 (544824) | 544824..545138 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
OHN14_RS02825 (545423) | 545423..546559 | - | 1137 | WP_000018685.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
OHN14_RS02830 (546644) | 546644..547147 | + | 504 | WP_001305117.1 | M48 family metallopeptidase | - |
OHN14_RS02835 (547224) | 547224..547907 | + | 684 | WP_001183060.1 | vancomycin high temperature exclusion protein | - |
OHN14_RS02840 (547986) | 547986..548972 | + | 987 | WP_001446103.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T262097 WP_000550189.1 NZ_CP109775:c545138-544824 [Shigella sonnei]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14979.42 Da Isoelectric Point: 4.4547
>AT262097 WP_000560263.1 NZ_CP109775:c544827-544411 [Shigella sonnei]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLADLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLADLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|