Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3886953..3887550 | Replicon | chromosome |
Accession | NZ_CP109772 | ||
Organism | Klebsiella pneumoniae strain YZ-58 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | M4Z05_RS19455 | Protein ID | WP_004142563.1 |
Coordinates | 3887233..3887550 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | M4Z05_RS19450 | Protein ID | WP_004142561.1 |
Coordinates | 3886953..3887240 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4Z05_RS19420 (M4Z05_19425) | 3883033..3883281 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
M4Z05_RS19425 (M4Z05_19430) | 3883299..3883640 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
M4Z05_RS19430 (M4Z05_19435) | 3883671..3884786 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
M4Z05_RS19435 (M4Z05_19440) | 3884966..3885547 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
M4Z05_RS19440 (M4Z05_19445) | 3885547..3885915 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
M4Z05_RS19445 (M4Z05_19450) | 3886035..3886688 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
M4Z05_RS19450 (M4Z05_19455) | 3886953..3887240 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M4Z05_RS19455 (M4Z05_19460) | 3887233..3887550 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4Z05_RS19460 (M4Z05_19465) | 3887735..3888778 | - | 1044 | WP_020802450.1 | DUF2157 domain-containing protein | - |
M4Z05_RS19465 (M4Z05_19470) | 3889448..3890314 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
M4Z05_RS19470 (M4Z05_19475) | 3890423..3891850 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T262090 WP_004142563.1 NZ_CP109772:c3887550-3887233 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |