Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 322338..322924 | Replicon | chromosome |
| Accession | NZ_CP109772 | ||
| Organism | Klebsiella pneumoniae strain YZ-58 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A483J4H8 |
| Locus tag | M4Z05_RS01945 | Protein ID | WP_064149238.1 |
| Coordinates | 322556..322924 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | M4Z05_RS01940 | Protein ID | WP_004174006.1 |
| Coordinates | 322338..322559 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4Z05_RS01920 (M4Z05_01920) | 318495..319421 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| M4Z05_RS01925 (M4Z05_01925) | 319418..320695 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| M4Z05_RS01930 (M4Z05_01930) | 320692..321459 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| M4Z05_RS01935 (M4Z05_01935) | 321461..322174 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| M4Z05_RS01940 (M4Z05_01940) | 322338..322559 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M4Z05_RS01945 (M4Z05_01945) | 322556..322924 | + | 369 | WP_064149238.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M4Z05_RS01950 (M4Z05_01950) | 323197..324513 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| M4Z05_RS01955 (M4Z05_01955) | 324620..325507 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| M4Z05_RS01960 (M4Z05_01960) | 325504..326349 | + | 846 | WP_004174009.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| M4Z05_RS01965 (M4Z05_01965) | 326351..327421 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 319418..328158 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13568.97 Da Isoelectric Point: 8.6410
>T262081 WP_064149238.1 NZ_CP109772:322556-322924 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTLGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTLGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483J4H8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |