Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 322338..322924 Replicon chromosome
Accession NZ_CP109772
Organism Klebsiella pneumoniae strain YZ-58

Toxin (Protein)


Gene name doc Uniprot ID A0A483J4H8
Locus tag M4Z05_RS01945 Protein ID WP_064149238.1
Coordinates 322556..322924 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M4Z05_RS01940 Protein ID WP_004174006.1
Coordinates 322338..322559 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4Z05_RS01920 (M4Z05_01920) 318495..319421 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M4Z05_RS01925 (M4Z05_01925) 319418..320695 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M4Z05_RS01930 (M4Z05_01930) 320692..321459 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M4Z05_RS01935 (M4Z05_01935) 321461..322174 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M4Z05_RS01940 (M4Z05_01940) 322338..322559 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M4Z05_RS01945 (M4Z05_01945) 322556..322924 + 369 WP_064149238.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M4Z05_RS01950 (M4Z05_01950) 323197..324513 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M4Z05_RS01955 (M4Z05_01955) 324620..325507 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M4Z05_RS01960 (M4Z05_01960) 325504..326349 + 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M4Z05_RS01965 (M4Z05_01965) 326351..327421 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 319418..328158 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(22-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13568.97 Da        Isoelectric Point: 8.6410

>T262081 WP_064149238.1 NZ_CP109772:322556-322924 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTLGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT262081 WP_004174006.1 NZ_CP109772:322338-322559 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483J4H8

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References