Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2471874..2472523 | Replicon | chromosome |
| Accession | NZ_CP109753 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-131-01A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OI984_RS12110 | Protein ID | WP_045352827.1 |
| Coordinates | 2471874..2472227 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1H8WUL1 |
| Locus tag | OI984_RS12115 | Protein ID | WP_045352829.1 |
| Coordinates | 2472224..2472523 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI984_RS12085 (OI984_12085) | 2468292..2469104 | + | 813 | WP_045352820.1 | hypothetical protein | - |
| OI984_RS12090 (OI984_12090) | 2469601..2469771 | - | 171 | WP_164725120.1 | hypothetical protein | - |
| OI984_RS12095 (OI984_12095) | 2469951..2470808 | + | 858 | WP_045352822.1 | WYL domain-containing protein | - |
| OI984_RS12100 (OI984_12100) | 2470821..2471018 | - | 198 | WP_045352823.1 | toxin-antitoxin system HicB family antitoxin | - |
| OI984_RS12105 (OI984_12105) | 2471102..2471443 | + | 342 | WP_045352825.1 | SymE family type I addiction module toxin | - |
| OI984_RS12110 (OI984_12110) | 2471874..2472227 | + | 354 | WP_045352827.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OI984_RS12115 (OI984_12115) | 2472224..2472523 | + | 300 | WP_045352829.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OI984_RS12120 (OI984_12120) | 2472553..2472990 | - | 438 | WP_045352830.1 | acetyltransferase | - |
| OI984_RS12125 (OI984_12125) | 2473057..2474103 | - | 1047 | WP_045352831.1 | class I SAM-dependent methyltransferase | - |
| OI984_RS12130 (OI984_12130) | 2474182..2474706 | - | 525 | WP_008500115.1 | lipocalin family protein | - |
| OI984_RS12135 (OI984_12135) | 2474824..2475549 | + | 726 | WP_008500116.1 | MerR family transcriptional regulator | - |
| OI984_RS12140 (OI984_12140) | 2475649..2476059 | + | 411 | WP_008500117.1 | hydroxyisourate hydrolase | - |
| OI984_RS12145 (OI984_12145) | 2476162..2477121 | + | 960 | WP_032675710.1 | DUF523 and DUF1722 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13508.45 Da Isoelectric Point: 8.8479
>T262069 WP_045352827.1 NZ_CP109753:2471874-2472227 [Enterobacter roggenkampii]
VDGSVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKELRIQYAGRPVRAFFAFDPVRQA
IVLCAGDKSNDKTFYEKMIRIADAEFSLHLTSQEAAK
VDGSVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKELRIQYAGRPVRAFFAFDPVRQA
IVLCAGDKSNDKTFYEKMIRIADAEFSLHLTSQEAAK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|