Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3811188..3811750 | Replicon | chromosome |
Accession | NZ_CP109744 | ||
Organism | Citrobacter portucalensis strain 2017-45-163 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OI981_RS18325 | Protein ID | WP_060683726.1 |
Coordinates | 3811472..3811750 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6H3AUF8 |
Locus tag | OI981_RS18320 | Protein ID | WP_003833018.1 |
Coordinates | 3811188..3811472 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI981_RS18305 (OI981_18295) | 3808883..3809767 | + | 885 | WP_003833024.1 | formate dehydrogenase N subunit beta | - |
OI981_RS18310 (OI981_18300) | 3809760..3810416 | + | 657 | WP_003020054.1 | formate dehydrogenase-N subunit gamma | - |
OI981_RS18315 (OI981_18305) | 3810546..3811148 | + | 603 | WP_060682194.1 | inorganic diphosphatase | - |
OI981_RS18320 (OI981_18310) | 3811188..3811472 | - | 285 | WP_003833018.1 | HigA family addiction module antitoxin | Antitoxin |
OI981_RS18325 (OI981_18315) | 3811472..3811750 | - | 279 | WP_060683726.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OI981_RS18330 (OI981_18320) | 3811971..3813686 | - | 1716 | WP_192464120.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
OI981_RS18335 (OI981_18325) | 3813996..3815693 | - | 1698 | WP_043016305.1 | malate dehydrogenase | - |
OI981_RS18340 (OI981_18330) | 3815873..3816013 | - | 141 | WP_003833009.1 | stationary-phase-induced ribosome-associated protein | - |
OI981_RS18345 (OI981_18335) | 3816241..3816672 | + | 432 | WP_003833007.1 | peroxiredoxin OsmC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10649.27 Da Isoelectric Point: 9.8965
>T262058 WP_060683726.1 NZ_CP109744:c3811750-3811472 [Citrobacter portucalensis]
MIMNFRHKGLRDLFLHGRTSGVIAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGERDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLHGRTSGVIAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGERDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|